FlhF pep alignment: Revision history

Jump to navigation Jump to search

Diff selection: Mark the radio buttons of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

18 June 2013

  • curprev 20:3720:37, 18 June 2013imported>Rayrah 26,928 bytes +26,928 Created page with "<pre> CLUSTAL W (1.81) multiple sequence alignment Pstutzeri_DSM10701_FlhF MQVKRFFAADMRIAMKMVRDELGADAAIVGNRRVAGGVELTAVLDYPM-EPATPHRANPA Pstutzeri_CCUG29243_FlhF ..."