Flhf pep alignment: Revision history

Jump to navigation Jump to search

Diff selection: Mark the radio buttons of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

18 June 2013

  • curprev 18:4718:47, 18 June 2013imported>Weigang 26,927 bytes +26,927 Created page with "<pre> CLUSTAL W (1.81) multiple sequence alignment DSM10701_Pstutzeri_FlhF MQVKRFFAADMRIAMKMVRDELGADAAIVGNRRVAGGVELTAVLDYPM-EPATPHRANPA CCUG29243_Pstutzeri_FlhF ..."